Proteintech, 98621-2-RR, Anti-Human IL12RB2 Rabbit Recombinant Antibody

Size: 100ug The IL12RB2 (98621-2-RR) by Proteintech is a Recombinant antibody targeting IL12RB2 in FC applications with reactivity to human samples 98621-2-RR targets IL12RB2 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: PHA treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4745 Product name: recombinant human IL12RB2 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-320 aa of NM_001559.2 Sequence: KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEE Predict reactive species Full Name: interleukin 12 receptor, beta 2 Calculated Molecular Weight: 97 kDa GenBank Accession Number: NM_001559.2 Gene Symbol: IL12RB2 Gene ID (NCBI): 3595 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99665-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.