Iright
BRAND / VENDOR: Proteintech

Proteintech, 98626-2-RR, Anti-Human LTBR Rabbit Recombinant Antibody

CATALOG NUMBER: 98626-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The LTBR (98626-2-RR) by Proteintech is a Recombinant antibody targeting LTBR in FC applications with reactivity to human samples 98626-2-RR targets LTBR in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs, HeLa cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Lymphotoxin-beta receptor (LTBR) is a receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It can activate the NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) (PMID: 24248355). LTBR is constitutively expressed on stromal cells and myeloid lineage cells but not on T or B lymphocytes, which may be a novel immune checkpoint of tumor-associated macrophages (PMID: 20603617; 39429877). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5126 Product name: Recombinant Human LTBR protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 31-227 aa of BC026262 Sequence: QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM Predict reactive species Full Name: lymphotoxin beta receptor (TNFR superfamily, member 3) Calculated Molecular Weight: 435 aa, 47 kDa GenBank Accession Number: BC026262 Gene Symbol: LTBR Gene ID (NCBI): 4055 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36941 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924