Iright
BRAND / VENDOR: Proteintech

Proteintech, 98630-2-RR, Anti-Mouse Gzma Rabbit Recombinant Antibody

CATALOG NUMBER: 98630-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The Gzma (98630-2-RR) by Proteintech is a Recombinant antibody targeting Gzma in FC (Intra) applications with reactivity to mouse samples 98630-2-RR targets Gzma in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: CD3/CD28 and Brefeldin A treated mouse splenocytes Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Granzyme A (GrA, a tryptase) is necessary for target cell lysis in cell-mediated immune responses. It activates mitochondrial outer membrane permeabilization- and caspase-independent cell death pathways by cleaving the mitochondrial complex I component NDUFS3after lys56. Among serine proteases GrA has an unique quaternary structure consisting of a disulphide-linked homodimer of 60kDa linked via Cys93. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3026 Product name: recombinant mouse Gzma protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-260 aa of NM_010370.3 Sequence: ERIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV Predict reactive species Full Name: granzyme A Calculated Molecular Weight: 29 kDa GenBank Accession Number: NM_010370.3 Gene Symbol: Gzma Gene ID (NCBI): 14938 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11032-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924