Proteintech, 98658-2-RR, Anti-Mouse TNFSF15 Rabbit Recombinant Antibody

Size: 100ug The TNFSF15 (98658-2-RR) by Proteintech is a Recombinant antibody targeting TNFSF15 in FC applications with reactivity to mouse samples 98658-2-RR targets TNFSF15 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tumor necrosis factor ligand superfamily member 15 (TNFSF15) is also named as TL1 and VEGI. And it belongs to the tumor necrosis factor family. It is a receptor for TNFRSF25 and TNFRSF6B. VEGI induced degradation of IκB alpha, and nuclear translocation of p65 subunit of NFκB by activating NFκB (PMID: 10597252). TL1A mediates activation and apoptosis of NFκB in DR3-expressing cell lines (PMID: 11911831). Overexpression by cancer cells of a secretable VEGI fusion protein resulted in abrogation of xenograft tumor progression. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5273 Product name: Recombinant Mouse TNFSF15 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-252 aa of / Sequence: AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 15 Calculated Molecular Weight: 28 kDa GenBank Accession Number: / Gene Symbol: Tnfsf15 Gene ID (NCBI): 326623 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5UBV8 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.