Iright
BRAND / VENDOR: Proteintech

Proteintech, 98679-1-RR, Anti-Mouse CD16/CD32 Rabbit Recombinant Antibody

CATALOG NUMBER: 98679-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD16/CD32 (98679-1-RR) by Proteintech is a Recombinant antibody targeting CD16/CD32 in FC applications with reactivity to mouse samples 98679-1-RR targets CD16/CD32 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD16 (FcγRIII) is a 50-70 kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD32 (FcγRII) is a 40 kD transmembrane glycoprotein that binds to the Fc region of IgG with low affinity. CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Rabbit anti mouse CD16/32 antibody, clone 252820A1 is specific to the common epitope of CD16 and CD32. It can be used for blocking non-specific binding of immunoglobulins to the Fc receptors by preincubating the cells with the purified antibody at 1 ug per million cells in 100 uL volume for 5-10 minutes prior to immunostaining. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3474 Product name: Recombinant Mouse CD16 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 31-215 aa of NM_001356511 Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT Predict reactive species Full Name: Fc receptor, IgG, low affinity III Calculated Molecular Weight: 30 kDa GenBank Accession Number: NM_001356511 Gene Symbol: Fcgr3 Gene ID (NCBI): 14131 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08508 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924