Proteintech, 98687-2-RR, Anti-Mouse IL3RA/CD123 Rabbit Recombinant Antibody

Size: 100ug The IL3RA/CD123 (98687-2-RR) by Proteintech is a Recombinant antibody targeting IL3RA/CD123 in FC applications with reactivity to mouse samples 98687-2-RR targets IL3RA/CD123 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-3RA, also named as CD123 and SUT-1, is the alpha subunit of the interleukin 3 (IL-3) receptor, which is part of the type I cytokine receptor superfamily (PMID: 25043189). It can regulate the proliferation, survival, and differentiation of hematopoietic cells. In mouse, there are two classes of high-affinity IL-3 receptors. One contains an IL-3-specific beta subunit and the other contains the beta subunit also shared by high-affinity IL-5 and GM-CSF receptors. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6614 Product name: Recombinant mouse IL3RA/CD123 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-331 aa of NM_008369 Sequence: SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK Predict reactive species Full Name: interleukin 3 receptor, alpha chain Calculated Molecular Weight: 43 kDa GenBank Accession Number: NM_008369 Gene Symbol: Il3ra Gene ID (NCBI): 16188 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26952 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.