Iright
BRAND / VENDOR: Proteintech

Proteintech, 98709-3-RR, Anti-Human TEM1/CD248 Rabbit Recombinant Antibody

CATALOG NUMBER: 98709-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The TEM1/CD248 (98709-3-RR) by Proteintech is a Recombinant antibody targeting TEM1/CD248 in FC applications with reactivity to human samples 98709-3-RR targets TEM1/CD248 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood lymphocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TEM1 (Tumor endothelial marker 1), also named as CD248, Endosialin and CD164L1, is a C-type lectin-like domain (CTLD) containing type I transmembrane glycoprotein. It is now considered to be a highly selective marker for activated perivascular and stromal cells, detected in most cancers and at least some inflammatory disorders. CD248 plays a role in tumor angiogenesis. It is a potential diagnostic tool and therapeutic target of inflammatory and malignant disease. Two isoforms of human TEM1 exist. The calculated molecular weights of the two isoforms are 81 kDa and 46 kDa, respectively. Native TEM1 can be glycosylated, and the glycosylated form has a larger apparent molecular weight than 81 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4427 Product name: recombinant human CD248 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-360 aa of BC051340 Sequence: QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA Predict reactive species Full Name: CD248 molecule, endosialin Calculated Molecular Weight: 757 aa, 81 kDa GenBank Accession Number: BC051340 Gene Symbol: TEM1 Gene ID (NCBI): 57124 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9HCU0 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924