Iright
BRAND / VENDOR: Proteintech

Proteintech, 98710-2-RR, Anti-Mouse IL-11 Rabbit Recombinant Antibody

CATALOG NUMBER: 98710-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-11 (98710-2-RR) by Proteintech is a Recombinant antibody targeting IL-11 in FC (Intra) applications with reactivity to mouse samples 98710-2-RR targets IL-11 in FC (Intra) applications and shows reactivity with mouse samples. Tested Applications Positive FC (Intra) detected in: Transfected CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-11 is a member of the interleukin family of cytokines. It was discovered in the late 20th century as researchers were exploring various cytokines involved in immune responses and cell growth regulation. IL-11 has significant effects on hematopoietic cells. It can stimulate the proliferation and differentiation of megakaryocytes, which are the precursors of platelets. This action helps in the regulation of platelet production. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2935 Product name: recombinant mouse Il11 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-199 aa of NM_008350.4 Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL Predict reactive species Full Name: interleukin 11 Calculated Molecular Weight: 22 kDa GenBank Accession Number: NM_008350.4 Gene Symbol: Il11 Gene ID (NCBI): 16156 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P47873 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924