Proteintech, 98712-3-RR, Anti-Pig IL-10 Rabbit Recombinant Antibody

Size: 100ug The IL-10 (98712-3-RR) by Proteintech is a Recombinant antibody targeting IL-10 in FC (Intra) applications with reactivity to pig samples 98712-3-RR targets IL-10 in FC (Intra) applications and shows reactivity with pig samples. Tested Applications Positive FC (Intra) detected in: CHO cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin (IL)-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4868 Product name: Recombinant Pig IL-10 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 19-175 aa of NM_214041.1 Sequence: SIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN Predict reactive species Full Name: Interleukin-10 Calculated Molecular Weight: 20 kDa GenBank Accession Number: NM_214041.1 Gene Symbol: IL-10 Gene ID (NCBI): 397106 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q29055 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.