Iright
BRAND / VENDOR: Proteintech

Proteintech, 98730-1-RR, Anti-Pig CXCL8/IL-8 Rabbit Recombinant Antibody

CATALOG NUMBER: 98730-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CXCL8/IL-8 (98730-1-RR) by Proteintech is a Recombinant antibody targeting CXCL8/IL-8 in FC applications with reactivity to pig samples 98730-1-RR targets CXCL8/IL-8 in FC applications and shows reactivity with pig samples. Tested Applications Positive FC detected in: Transfected CHO cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Interleukin 8 (IL-8), also known as CXCL8, which is a member of the CXC chemokine family. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. Specification Tested Reactivity: pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4863 Product name: Recombinant Pig CXCL8/IL-8 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-103 aa of NM_213867.1 Sequence: ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ Predict reactive species Full Name: Interleukin-8 Calculated Molecular Weight: 12 kDa GenBank Accession Number: NM_213867.1 Gene Symbol: IL-8 Gene ID (NCBI): 396880 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26894 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924