Iright
BRAND / VENDOR: Proteintech

Proteintech, 98732-2-RR, Anti-Rat IL-1 alpha Rabbit Recombinant Antibody

CATALOG NUMBER: 98732-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-1 alpha (98732-2-RR) by Proteintech is a Recombinant antibody targeting IL-1 alpha in FC applications with reactivity to rat samples 98732-2-RR targets IL-1 alpha in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: Transfected HEK-293T cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4641 Product name: Recombinant Rat IL-1 alpha protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 115-270 aa of NM_017019.1 Sequence: SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS Predict reactive species Full Name: interleukin 1 alpha Calculated Molecular Weight: 31kDa GenBank Accession Number: NM_017019.1 Gene Symbol: Il1a Gene ID (NCBI): 24493 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16598 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924