Proteintech, 98738-2-RR, Anti-Human CD179b Rabbit Recombinant Antibody

Size: 100ug The CD179b (98738-2-RR) by Proteintech is a Recombinant antibody targeting CD179b in FC applications with reactivity to human samples 98738-2-RR targets CD179b in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: NALM-6 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD179b, also known as IGLL1, VpreB (surrogate light chain, VpreB1), is a crucial protein component of the pre-B cell receptor (pre-BCR), which is essential for the early development of B lymphocytes (B cells) in the bone marrow. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3515 Product name: recombinant human IGLL1 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 38-213 aa of BC012293 Sequence: LLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS Predict reactive species Full Name: immunoglobulin lambda-like polypeptide 1 Calculated Molecular Weight: 213 aa, 23 kDa GenBank Accession Number: BC012293 Gene Symbol: IGLL1 Gene ID (NCBI): 3543 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15814 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.