Iright
BRAND / VENDOR: Proteintech

Proteintech, 98764-1-RR, Anti-Mouse CD103 Rabbit Recombinant Antibody

CATALOG NUMBER: 98764-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD103 (98764-1-RR) by Proteintech is a Recombinant antibody targeting CD103 in FC applications with reactivity to mouse samples 98764-1-RR targets CD103 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD103, also known as integrin alpha-E (ITGAE) or integrin alpha-IEL, is a type I transmembrane integrin protein that binds integrin beta 7 to form Integrin alpha-E beta-7 which is a receptor for E-cadherin and mediates adhesion of T lymphocytes to epithelial cells (PMID: 7969453; 8468482). CD103 is expressed on intraepithelial lymphocyte (IEL) T cells (both alpha/beta T cells and gamma/delta T cells), some peripheral regulatory T cells (Tregs), lamina propria T cells, and a subset of dendritic cells in the gut mucosa and mesenteric lymph nodes (PMID: 12242333; 15608520; 16216890). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg10465 Product name: Recombinant mouse ITAE protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-Twin-Strep-Tag Domain: 669-1114 aa of Sequence: RPVVDLTVSMTFTPDALPMVFIGKMDVKLCFEVDSSGVASEPGLREMFLNFTVDVDVTKQRQRLQCEDSSGCQSCLRKWNGGSFLCEHFWLISTEELCEEDCFSNITIKVTYEFQTSGGRRDYPNPTLDHYKEPSAIFQLPYEKDCKNKVFCIAEIQLTTNISQQELVVGVTKEVTMNISLTNSGEDSYMTNMALNYPRNLQFKKIQKPVSPDVQCDDPKPVASVLVMNCKIGHPILKRSSVNVSVTWQLEESVFPNRTADITVTISNSNEKSLARETRSLQFRHAFIAVLSRPSVMYMNTSQSPSDHKEFFFNVHGENLFGAVFQLQICVPIKLQDFQIVRVKNLTKTQDHTECTQSQEPACGSDPVQHVKEWHSVVCAITSNKENVTVAAEISVGHTKQLLRDVSELPILGEISFNKSLYEGLNAENHRTKITVIFLKEEETRS Predict reactive species Full Name: integrin alpha E, epithelial-associated Gene Symbol: CD103 Gene ID (NCBI): 16407 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924