Product Description
Size: 100ug
The IFN-gamma (APC-FcA98001) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra) applications with reactivity to rat samples
APC-FcA98001 targets IFN-gamma in FC (Intra) applications and shows reactivity with rat samples.
Tested Applications
Positive FC (Intra) detected in: ConA+PMA and ionomycin Stimulate rat splenocytes
Recommended dilution
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension
Background Information
Interferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427)
Specification
Tested Reactivity: rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg0400 Product name: Recombinant Rat IFN-gamma protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-156 aa of NM_138880 Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC Predict reactive species
Full Name: interferon gamma
Calculated Molecular Weight: 18 kDa
GenBank Accession Number: NM_138880
Gene Symbol: IFN-gamma
Gene ID (NCBI): 25712
Conjugate: APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P01581
Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924