Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98016, FcZero-rAb™ APC Anti-Human TLR3/CD283 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98016
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The TLR3/CD283 (APC-FcA98016) by Proteintech is a Recombinant antibody targeting TLR3/CD283 in FC (Intra) applications with reactivity to human samples APC-FcA98016 targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: human immature monocyte-derived dendritic cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension Background Information TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34044 Product name: Recombinant human TLR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 725-904 aa of BC094737 Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH Predict reactive species Full Name: toll-like receptor 3 Calculated Molecular Weight: 904 aa, 104 kDa GenBank Accession Number: BC094737 Gene Symbol: TLR3 Gene ID (NCBI): 7098 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15455 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924