Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98018, FcZero-rAb™ APC Anti-Mouse TLR4/CD284 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98018
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The TLR4/CD284 (APC-FcA98018) by Proteintech is a Recombinant antibody targeting TLR4/CD284 in FC applications with reactivity to mouse samples APC-FcA98018 targets TLR4/CD284 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: Balb/c mouse peritoneal macrophages Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in 100 μl suspension Background Information TLR4, also named as CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32998 Product name: Recombinant mouse Tlr4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-395 aa of NM_021297 Sequence: RENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLG Predict reactive species Full Name: toll-like receptor 4 Calculated Molecular Weight: 96 kDa GenBank Accession Number: NM_021297 Gene Symbol: Tlr4 Gene ID (NCBI): 21898 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9QUK6 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924