Proteintech, APC-FcA98028, FcZero-rAb™ APC Anti-Mouse MCP-1/CCL2 Rabbit Recombinant Antibody

Size: 100ug The MCP-1/CCL2 (APC-FcA98028) by Proteintech is a Recombinant antibody targeting MCP-1/CCL2 in FC applications with reactivity to mouse samples APC-FcA98028 targets MCP-1/CCL2 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: LPS and Brefeldin A treated RAW 264.7 cells Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information Monocyte chemotactic protein 1 (MCP-1), also known as CCL2, is chemotactic for monocyte/macrophage, B cell, and T cell, and belongs to the CC subfamily of chemokines. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0427 Product name: Recombinant Mouse MCP-1/CCL2 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species Full Name: chemokine (C-C motif) ligand 2 GenBank Accession Number: NM-011333 Gene Symbol: MCP-1/CCL2 Gene ID (NCBI): 20296 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Excitation Laser: Red Laser (633 nm) Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10148 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.