Proteintech, APC-FcA98056, FcZero-rAb™ APC Anti-Human TNF beta Rabbit Recombinant Antibody

Size: 100tests The TNF beta (APC-FcA98056) by Proteintech is a Recombinant antibody targeting TNF beta in FC (Intra) applications with reactivity to human samples APC-FcA98056 targets TNF beta in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: Anti-CD3/CD28 treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension Background Information TNF beta also known as lymphotoxin alpha (LTA), is a member of the tumor necrosis factor family, and is a cytokine produced by lymphocytes. TNF Beta is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. TNF Beta also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0836 Product name: Recombinant Human TNF-beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 35-205 aa of BC034729 Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Predict reactive species Full Name: lymphotoxin alpha (TNF superfamily, member 1) Calculated Molecular Weight: 205 aa, 22 kDa GenBank Accession Number: BC034729 Gene Symbol: TNF beta Gene ID (NCBI): 4049 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01374 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.