Proteintech, APC-FcA98095, FcZero-rAb™ APC Anti-Human CD9 Rabbit Recombinant Antibody

Size: 100tests The CD9 (APC-FcA98095) by Proteintech is a Recombinant antibody targeting CD9 in FC applications with reactivity to human samples APC-FcA98095 targets CD9 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species Full Name: CD9 molecule Calculated Molecular Weight: 25 kDa GenBank Accession Number: NM_001769.4 Gene Symbol: CD9 Gene ID (NCBI): 928 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21926 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.