Proteintech, APC-FcA98104, FcZero-rAb™ APC Anti-Human Tissue Factor/CD142 Rabbit Recombinant Antibody

Size: 100tests The Tissue Factor/CD142 (APC-FcA98104) by Proteintech is a Recombinant antibody targeting Tissue Factor/CD142 in FC applications with reactivity to human samples APC-FcA98104 targets Tissue Factor/CD142 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: LPS treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension Background Information Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named CD142, coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1052 Product name: Recombinant Human Coagulation Factor III/Tissue Factor protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 33-251 aa of NM_001993.5 Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE Predict reactive species Full Name: coagulation factor III (thromboplastin, tissue factor) Calculated Molecular Weight: 33 kDa GenBank Accession Number: NM_001993.5 Gene Symbol: F3 Gene ID (NCBI): 2152 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13726-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.