Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98156, FcZero-rAb™ APC Anti-Human CD209 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98156
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The CD209 (APC-FcA98156) by Proteintech is a Recombinant antibody targeting CD209 in FC applications with reactivity to human samples APC-FcA98156 targets CD209 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human monocyte-derived immature dendritic cells Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information CD209 (DC-SIGN, CLEC4L) is a C-type lectin receptor that is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens, including bacteria, viruses, and parasites. CD209 is preferentially expressed on dendritic cells (DCs). It mediates transient adhesion of DCs with T cells. It has been reported that CD209 plays a role in capture and transmission of HIV from DC to T cells (PMID: 10721995). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0062 Product name: Recombinant Human CD209 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 59-404 aa of BC110615 Sequence: QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA Predict reactive species Full Name: CD209 molecule Calculated Molecular Weight: 404 aa, 45.7 kDa GenBank Accession Number: BC110615 Gene Symbol: CD209 Gene ID (NCBI): 30835 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Excitation Laser: Red Laser (633 nm) Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NNX6 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924