Proteintech, APC-FcA98158, FcZero-rAb™ APC Anti-Mouse CD80 Rabbit Recombinant Antibody

Size: 100ug The CD80 (APC-FcA98158) by Proteintech is a Recombinant antibody targeting CD80 in FC applications with reactivity to mouse samples APC-FcA98158 targets CD80 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse peritoneal macrophages Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information CD80 (also known as B7-1) is a type I membrane protein that is a member of the immunoglobulin superfamily, with an extracellular immunoglobulin constant-like domain and a variable-like domain required for receptor binding. It is expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, monocytes, and macrophages. CD80 is the receptor for the proteins CD28 and CTLA-4 found on the surface of T-cells. It is involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. CD80 also acts as a cellular attachment receptor for adenovirus subgroup B. (PMID: 7545666; 12015893; 16920215) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0840 Product name: Recombinant Mouse CD80 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 38-246 aa of NM_009855.2 Sequence: VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKN Predict reactive species Full Name: CD80 antigen Calculated Molecular Weight: 35 kDa GenBank Accession Number: NM_009855.2 Gene Symbol: CD80 Gene ID (NCBI): 12519 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Excitation Laser: Red Laser (633 nm) Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q00609-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.