Proteintech, APC-FcA98170, FcZero-rAb™ APC Anti-Human CD48 Rabbit Recombinant Antibody

Size: 100tests The CD48 (APC-FcA98170) by Proteintech is a Recombinant antibody targeting CD48 in FC applications with reactivity to human samples APC-FcA98170 targets CD48 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information Signaling lymphocytic activation molecule family 2 (SLAMF2, CD48) is an adhesion and costimulatory molecule expressed constitutively on most hematopoietic cells, particularly in antigen-presenting cells (APC). CD48 is expressed on all the hematopoietic cells, both in humans and mice, except for murine neutrophils and long-term HSC. CD48 exists as both a membrane-bound (mCD48) and a soluble (sCD48) form. CD48 can activate T cells, antigen-presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high-affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD48 expression is increased in autoimmunity and allergy diseases, and anti-CD48 monoclonal antibodies have been shown to attenuate experimental autoimmune encephalomyelitis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1005 Product name: Recombinant Human CD48 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 27-220 aa of BC016182 Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS Predict reactive species Full Name: CD48 molecule Calculated Molecular Weight: 43 kDa GenBank Accession Number: BC016182 Gene Symbol: CD48 Gene ID (NCBI): 962 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09326 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.