Product Description
Size: 100ug
The CD79b (APC-FcA98217) by Proteintech is a Recombinant antibody targeting CD79b in FC applications with reactivity to mouse samples
APC-FcA98217 targets CD79b in FC applications and shows reactivity with mouse samples.
Tested Applications
Positive FC detected in: mouse bone marrow cells
Recommended dilution
Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension
Background Information
CD79 molecule encompasses two transmembrane proteins, CD79a and CD79b, which form a disulfide-linked heterodimer and are members of the immunoglobulin (Ig) gene superfamily (PMID: 2033258; 1375264; 2304550). CD79b molecule (also known as B29, IGB, AGM6, and Igbeta) is expressed almost exclusively on B cells and B-cell neoplasms, influencing antigen internalization and increasing antigen presentation efficiency (PMID: 7552998). CD79b mutation could be a key biomarker for DLBCL disease progression (PMID: 36182550).
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg2113 Product name: Recombinant Mouse CD79B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-158 aa of NM_008339.3 Sequence: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD Predict reactive species
Full Name: CD79B antigen
Calculated Molecular Weight: 26 kDa
GenBank Accession Number: NM_008339.3
Gene Symbol: Cd79b
Gene ID (NCBI): 15985
Conjugate: APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P15530
Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924