Proteintech, APC-FcA98235, FcZero-rAb™ APC Anti-Human CD300e Rabbit Recombinant Antibody

Size: 100tests The CD300e (APC-FcA98235) by Proteintech is a Recombinant antibody targeting CD300e in FC applications with reactivity to human samples APC-FcA98235 targets CD300e in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information CD300e, also known as immune receptor expressed on myeloid cells 2 (IREM-2), CLM-2, or CMRF35-A5, is one of the CD300 family members which belong to the immunoglobulin (Ig) superfamily (PMID: 15557162; 20039296). CD300e is a type I transmembrane glycoprotein that contains an extracellular region comprising an Ig-like domain, a transmembrane region, and a short cytoplasmic tail (PMID: 15557162; 29358324). It is by monocytes and myeloid dendritic cells and transmits an immune-activating signal by interacting with DNAX-activating protein 12 (DAP12) (PMID: 29358324). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2638 Product name: recombinant human CD300E protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-131 aa of NM_181449.2 Sequence: KGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKVERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAI Predict reactive species Full Name: CD300e molecule Calculated Molecular Weight: 23 kDa GenBank Accession Number: NM_181449.2 Gene Symbol: CD300E Gene ID (NCBI): 342510 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q496F6 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.