Proteintech, APC-FcA98289, FcZero-rAb™ APC Anti-Mouse FceR1a Rabbit Recombinant Antibody

Size: 100ug The FceR1a (APC-FcA98289) by Proteintech is a Recombinant antibody targeting FceR1a in FC applications with reactivity to mouse samples APC-FcA98289 targets FceR1a in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: MC/9 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Fc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex, FceRI, with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1740 Product name: Recombinant Mouse Fc-epsilon RI-alpha (FcERI) protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-204 aa of NM_010184.2 Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ Predict reactive species Full Name: Fc receptor, IgE, high affinity I, alpha polypeptide Calculated Molecular Weight: 29 kDa GenBank Accession Number: NM_010184.2 Gene Symbol: FceR1a Gene ID (NCBI): 14125 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20489 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.