Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98456-3, FcZero-rAb™ APC Anti-Mouse CD47 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98456-3
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD47 (APC-FcA98456-3) by Proteintech is a Recombinant antibody targeting CD47 in FC applications with reactivity to mouse samples APC-FcA98456-3 targets CD47 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1394 Product name: Recombinant Mouse CD47 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NP_001355344.1 Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK Predict reactive species Full Name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer) Calculated Molecular Weight: 33 kDa GenBank Accession Number: NP_001355344.1 Gene Symbol: Cd47 Gene ID (NCBI): 16423 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61735-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924