Proteintech, AY7-FcA98287, FcZero-rAb™ APC-Cyanine7 Anti-Mouse CD19 Rabbit Recombinant Antibody

Size: 100ug The CD19 (AY7-FcA98287) by Proteintech is a Recombinant antibody targeting CD19 in FC applications with reactivity to mouse samples AY7-FcA98287 targets CD19 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD19 is a 95 kDa type I transmembrane glycoprotein belonging to the immunoglobulin superfamily (PMID: 2472450). It is expressed by B cells and follicular dendritic cells. CD19 is up-regulated at the step of B-lineage commitment during the differentiation of the hematopoietic stem cell, it remains on during subsequent stages of differentiation until finally down-regulated during terminal differentiation into plasma cells (PMID: 8528044). CD19 is involved in B cell development, activation and differentiation. It is the dominant component for the signaling complex on B cells that includes CD21 (CR2), CD81 (TAPA-1) and CD225 and acts as a critical co-receptor for BCR signal transduction (PMID: 23210908). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3194 Product name: Recombinant Mouse CD19 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-287 aa of NM_009844.2 Sequence: RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG Predict reactive species Full Name: CD19 antigen Calculated Molecular Weight: 60 kDa GenBank Accession Number: NM_009844.2 Gene Symbol: Cd19 Gene ID (NCBI): 12478 Conjugate: APC-Cyanine7 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 778 nm Excitation Laser: Red Laser (633 nm) Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25918 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.