Proteintech, Biotin-FcA98196, FcZero-rAb™ Biotin Anti-Mouse CSF2RA/CD116 Rabbit Recombinant Antibody

Size: 100ug The CSF2RA/CD116 (Biotin-FcA98196) by Proteintech is a Recombinant antibody targeting CSF2RA/CD116 in FC, ELISA applications with reactivity to mouse samples Biotin-FcA98196 targets CSF2RA/CD116 in FC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD116, also named as CSF2RA CDw116 CSF2RAX CSF2RAY CSF2RX CSF2RY GM-CSF-R-alpha GMCSFR and GMR, is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CD116 transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2016 Product name: Recombinant Mouse CSF2RA/CD116 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-327 aa of NM_009970.2 Sequence: LLAPTTPDAGSALNLTFDPWTRTLTWACDTAAGNVTVTSCTVTSREAGIHRRVSPFGCRCWFRRMMALHHGVTLDVNGTVGGAAAHWRLSFVNEGAAGSGAENLTCEIRAARFLSCAWREGPAAPADVRYSLRVLNSTGHDVARCMADPGDDVITQCIANDLSLLGSEAYLVVTGRSGAGPVRFLDDVVATKALERLGPPRDVTASCNSSHCTVSWAPPSTWASLTARDFQFEVQWQSAEPGSTPRKVLVVEETRLAFPSPAPHGGHKVKVRAGDTRMKHWGEWSPAHPLEAEDTRVP Predict reactive species Full Name: colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) Calculated Molecular Weight: 42kDa GenBank Accession Number: NM_009970.2 Gene Symbol: CSF2RA/CD116 Gene ID (NCBI): 12982 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q00941 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.