Product Description
Size: 100ug
The CD81 (Biotin-FcA98202) by Proteintech is a Recombinant antibody targeting CD81 in FC, ELISA applications with reactivity to human samples
Biotin-FcA98202 targets CD81 in FC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive FC detected in: human peripheral blood leukocytes
Recommended dilution
Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg1036 Product name: recombinant human CD81 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 113-201 aa of NM_004356.4 Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Predict reactive species
Full Name: CD81 molecule
Calculated Molecular Weight: 26 kDa
GenBank Accession Number: NM_004356.4
Gene Symbol: CD81
Gene ID (NCBI): 975
ENSEMBL Gene ID: ENSG00000110651
Conjugate: Biotin
Excitation/Emission Maxima Wavelengths: -
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P60033
Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924