Proteintech, Biotin-FcA98203, FcZero-rAb™ Biotin Anti-Human IL-4RA/CD124 Rabbit Recombinant Antibody

Size: 100ug The IL-4RA/CD124 (Biotin-FcA98203) by Proteintech is a Recombinant antibody targeting IL-4RA/CD124 in FC, ELISA applications with reactivity to human samples Biotin-FcA98203 targets IL-4RA/CD124 in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4/IL-13 responses are involved in regulating IgE production and chemokine and mucus production at sites of allergic inflammation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1684 Product name: Recombinant Human IL-4 R alpha/CD124 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-232 aa of NM_000418.4 Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH Predict reactive species Full Name: interleukin 4 receptor Calculated Molecular Weight: 90 kDa GenBank Accession Number: NM_000418.4 Gene Symbol: IL-4R Gene ID (NCBI): 3566 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24394-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.