Proteintech, Biotin-FcA98222, FcZero-rAb™ Biotin Anti-Human CD37 Rabbit Recombinant Antibody

Size: 100ug The CD37 (Biotin-FcA98222) by Proteintech is a Recombinant antibody targeting CD37 in FC, ELISA applications with reactivity to human samples Biotin-FcA98222 targets CD37 in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1764 Product name: Recombinant Human CD37 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 112-241 aa of NM_001774.3 Sequence: RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN Predict reactive species Full Name: CD37 molecule Calculated Molecular Weight: 32kDa GenBank Accession Number: NM_001774.3 Gene Symbol: CD37 Gene ID (NCBI): 951 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11049-1 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.