Proteintech, Biotin-FcA98337, FcZero-rAb™ Biotin Anti-Human CD93 Rabbit Recombinant Antibody

Size: 100ug The CD93 (Biotin-FcA98337) by Proteintech is a Recombinant antibody targeting CD93 in FC, ELISA applications with reactivity to human samples Biotin-FcA98337 targets CD93 in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD93, also known as C1qR or C1qR(p), is a single-pass type I transmembrane glycoprotein and a member of the group 14 of the C-type lectin-like domain (CTLD) superfamily, which also includes endosialin/CD248, thrombomodulin, and CLEC14A (PMID: 31287944). CD93 consists of a C-type lectin-like domain, five EGF-like repeats, a mucin-like domain, a transmembrane domain and a cytoplasmic domain (PMID: 28912033). CD93 is mainly expressed on endothelial cells and has been reported to be expressed by neurons and various cells of the hematopoietic system, including monocytes, neutrophils, B cells, natural killer cells, platelets and hematopoietic stem cells (PMID: 37443812). CD93 plays a role in various physiological processes including angiogenesis, inflammation, and cell adhesion (PMID: 31287944). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2794 Product name: Recombinant Human CD93 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-580 aa of NM_012072.3 Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK Predict reactive species Full Name: CD93 molecule Calculated Molecular Weight: 69 kDa GenBank Accession Number: NM_012072.3 Gene Symbol: CD93 Gene ID (NCBI): 22918 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPY3 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.