Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-SF98229, Biotin Anti-Mouse CD147 Rabbit scFv Antibody

CATALOG NUMBER: Biotin-SF98229
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD147 (Biotin-SF98229) by Proteintech is a Recombinant antibody targeting CD147 in FC, ELISA applications with reactivity to mouse samples Biotin-SF98229 targets CD147 in FC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse thymocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211). Specification Tested Reactivity: mouse Host / Type: Rabbit / scFv Class: Recombinant Type: Single-chain variable fragment antibody (scFv) Immunogen: CatNo: Eg1530 Product name: Recombinant Mouse CD147 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-325 aa of NM_009768.2 Sequence: AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR Predict reactive species Full Name: basigin Calculated Molecular Weight: 42 kDa GenBank Accession Number: NM_009768.2 Gene Symbol: CD147 Gene ID (NCBI): 12215 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Source: Anti-Mouse CD147 scFv from clone 241852B4, consisting of VH-GGGGS linker-VL (N- to C-terminus), with His tag at the C-terminus. Form: Liquid Purification Method: Affinity purification Storage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924