Iright
BRAND / VENDOR: Proteintech

Proteintech, CL488-FcA98162, FcZero-rAb™ CoraLite® Plus 488 Anti-Rat CD90 Rabbit Recombinant Antibody

CATALOG NUMBER: CL488-FcA98162
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD90 (CL488-FcA98162) by Proteintech is a Recombinant antibody targeting CD90 in FC applications with reactivity to rat samples CL488-FcA98162 targets CD90 in FC applications and shows reactivity with rat samples. Tested Applications Positive FC detected in: rat thymocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034). Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species Full Name: Thy-1 cell surface antigen Calculated Molecular Weight: 18 kDa GenBank Accession Number: NM_012673.2 Gene Symbol: Thy1 Gene ID (NCBI): 24832 Conjugate: CoraLite® Plus 488 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01830 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924