Proteintech, CL488-FcA98187, FcZero-rAb™ CoraLite® Plus 488 Anti-Human IFN-gamma Rabbit Recombinant Antibody

Size: 100tests The IFN-gamma (CL488-FcA98187) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra) applications with reactivity to human samples CL488-FcA98187 targets IFN-gamma in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: PMA and ionomycin treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension Background Information Interferon gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. In its active form, IFN γ is a glycosylated, non-covalently linked homodimer of 29-32 kDa subunits. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins. (PMID: 19268625; 10688427) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0004 Product name: Recombinant Human IFN-gamma protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 24-161 aa of BC070256 Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG Predict reactive species Full Name: IFN gamma Calculated Molecular Weight: 166 aa, 19 kDa GenBank Accession Number: BC070256 Gene Symbol: IFNG Gene ID (NCBI): 3458 ENSEMBL Gene ID: ENSG00000111537 Conjugate: CoraLite® Plus 488 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01579 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.