Iright
BRAND / VENDOR: Proteintech

Proteintech, G14464-1-5C, MultiPro® 5CFLX Anti-Human TCF7 (Polyclonal)

CATALOG NUMBER: G14464-1-5C
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The TCF7 (G14464-1-5C) by Proteintech is a Polyclonal antibody targeting TCF7 in Single Cell (Intra) applications with reactivity to Human samples G14464-1-5C targets TCF7 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information TCF7, also known as TCF1, belongs to the TCF/LEF family. TCF7 is part of the Wnt signaling pathway and plays an important role in the differentiation and self-renewal of memory T cells. It has been found that TCF7 is necessary to revive T cells in response to PD-1 blockade against viral infection or cancer. TCF7 is mainly expressed in T-cells and is also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium. TCF7 has 16 isoforms with the molecular mass of 28-54 kDa (PMID: 34044317). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag5792 Product name: Recombinant human TCF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-384 aa of BC048769 Sequence: MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human TCF7 (Polyclonal) Calculated Molecular Weight: 42 kDa GenBank Accession Number: BC048769 Gene Symbol: TCF1/TCF7 Gene ID (NCBI): 6932 ENSEMBL Gene ID: ENSG00000081059 RRID: AB_3673888 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGCGCCTATAGAGACGCCCCATATAAGAAA Barcode Sequence: CGCCTATAGAGACGC Form: Liquid UNIPROT ID: P36402 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924