Iright
BRAND / VENDOR: Proteintech

Proteintech, G16637-1-5C, MultiPro® 5CFLX Anti-Human AHNAK (Polyclonal)

CATALOG NUMBER: G16637-1-5C
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The AHNAK (G16637-1-5C) by Proteintech is a Polyclonal antibody targeting AHNAK in Single Cell (Intra) applications with reactivity to Human samples G16637-1-5C targets AHNAK in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information AHNAK, also known as desmoyokin, is described as a giant scaffold protein based on its large size (629 kDa) and ability to interact with different proteins to form multi-protein complexes. The bulk of the protein is assembled in 128-residue repetitive elements known as the central repeated unit (CRU). Its proposed functions are quite diverse, ranging from a role in the formation of the blood brain barrier, in cell architecture and migration, to the regulation of cardiac channels and muscle membrane repair. AHNAK is differentially expressed in some cancer cell lines. The expression of AHNAK is subsequently localized to the plasma membrane of keratinocytes in human epidermis. AHNAK has been reported in many intracellular locations including the nucleus, cytoplasm and plasma membrane. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag9986 Product name: Recombinant human AHNAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC000926 Sequence: MEKEEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLNTPQPSALECKDQNKQKEASSQAGAVSVSTPNAG Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human AHNAK (Polyclonal) Calculated Molecular Weight: 629 kDa GenBank Accession Number: BC000926 Gene Symbol: AHNAK Gene ID (NCBI): 79026 ENSEMBL Gene ID: ENSG00000124942 RRID: AB_3673890 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGCTGCGTACAGGTGGACCCATATAAGAAA Barcode Sequence: CTGCGTACAGGTGGA Form: Liquid UNIPROT ID: Q09666 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924