Iright
BRAND / VENDOR: Proteintech

Proteintech, G66065-2-5C, MultiPro® 5CFLX Anti-Human CD31 (3F8E2)

CATALOG NUMBER: G66065-2-5C
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The CD31 (G66065-2-5C) by Proteintech is a Monoclonal antibody targeting CD31 in Single Cell (Intra), Single Cell applications with reactivity to Human samples G66065-2-5C targets CD31 in Single Cell (Intra), Single Cell applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Positive Single Cell detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test SINGLE CELL: <0.5ug/test Background Information Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag19730 Product name: Recombinant human CD31 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human CD31 (3F8E2) Calculated Molecular Weight: 83 kDa GenBank Accession Number: BC022512 Gene Symbol: CD31 Gene ID (NCBI): 5175 ENSEMBL Gene ID: ENSG00000261371 RRID: AB_3673942 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGTATAACACCTGGTATCCCATATAAGAAA Barcode Sequence: TATAACACCTGGTAT Form: Liquid UNIPROT ID: P16284 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924