Proteintech, G66224-1-5C, MultiPro® 5CFLX Anti-Human CD43 (2A11D6)

Size: 10ug The CD43 (G66224-1-5C) by Proteintech is a Monoclonal antibody targeting CD43 in Single Cell (Intra) applications with reactivity to Human samples G66224-1-5C targets CD43 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information CD43, also named leukosialin, sialophorin, galactoglycoprotein, leukocyte sialoglycoprotein, SPN, and is a mucin-like type I transmembrane protein. In humans, it is expressed in haematopoietic cells, including T lymphocytes, monocytes, granulocytes, natural killer cells, platelets, and haematopoietic stem cells, with the exception of mature erythrocytes and B cell subpopulations. The unglycosylated form of CD43 migrates on SDS-PAGE with a molecular weight of 54 kDa (PMID: 2943740), whereas CD43 from different haematopoietic cell lines displays increased molecular weights since it is glycosylated with O-linked chains that differ in core structure and sialylation. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag23595 Product name: Recombinant human SPN protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 101-400 aa of BC012350 Sequence: KMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human CD43 (2A11D6) Calculated Molecular Weight: 400 aa, 43 kDa GenBank Accession Number: BC012350 Gene Symbol: CD43 Gene ID (NCBI): 6693 ENSEMBL Gene ID: ENSG00000197471 RRID: AB_3673945 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGCCACAATCCTAACGGCCCATATAAGAAA Barcode Sequence: CCACAATCCTAACGG Form: Liquid UNIPROT ID: P16150 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.