Proteintech, G66321-1-5C, MultiPro® 5CFLX Anti-Human Fascin (1B5G3)

Size: 10ug The Fascin (G66321-1-5C) by Proteintech is a Monoclonal antibody targeting Fascin in Single Cell (Intra) applications with reactivity to Human samples G66321-1-5C targets Fascin in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag6074 Product name: Recombinant human Fascin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human Fascin (1B5G3) Calculated Molecular Weight: 55 kDa GenBank Accession Number: BC000521 Gene Symbol: Fascin Gene ID (NCBI): 6624 ENSEMBL Gene ID: ENSG00000075618 RRID: AB_3673947 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGCCGTTCGCGGTACGCCCATATAAGAAA Barcode Sequence: GCCGTTCGCGGTACG Form: Liquid UNIPROT ID: Q16658 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.