Proteintech, G66659-1-5C, MultiPro® 5CFLX Anti-Human POU2AF1 (3C5A7)

Size: 10ug The POU2AF1 (G66659-1-5C) by Proteintech is a Monoclonal antibody targeting POU2AF1 in Single Cell (Intra) applications with reactivity to Human samples G66659-1-5C targets POU2AF1 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information POU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag23613 Product name: Recombinant human POU2AF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC032549 Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human POU2AF1 (3C5A7) Calculated Molecular Weight: 256 aa, 27 kDa GenBank Accession Number: BC032549 Gene Symbol: POU2AF1 Gene ID (NCBI): 5450 ENSEMBL Gene ID: ENSG00000110777 RRID: AB_3673958 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGGTATCCGCAAGCGTCCCATATAAGAAA Barcode Sequence: GGTATCCGCAAGCGT Form: Liquid UNIPROT ID: Q16633 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.