Iright
BRAND / VENDOR: Proteintech

Proteintech, G66737-1-5C, MultiPro® 5CFLX Anti-Human IL-1 Beta (2A1B4)

CATALOG NUMBER: G66737-1-5C
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The IL-1 Beta (G66737-1-5C) by Proteintech is a Monoclonal antibody targeting IL-1 Beta in Single Cell (Intra) applications with reactivity to Human samples G66737-1-5C targets IL-1 Beta in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human IL-1 Beta (2A1B4) Calculated Molecular Weight: 269 aa, 31 kDa GenBank Accession Number: BC008678 Gene Symbol: IL1B Gene ID (NCBI): 3553 ENSEMBL Gene ID: ENSG00000125538 RRID: AB_3673960 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGTGAGTGGATTGTTCTCCCATATAAGAAA Barcode Sequence: TGAGTGGATTGTTCT Form: Liquid UNIPROT ID: P01584 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924