Iright
BRAND / VENDOR: Proteintech

Proteintech, G68007-1-5C, MultiPro® 5CFLX Anti-Human Sortilin (2B11B9)

CATALOG NUMBER: G68007-1-5C
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The Sortilin (G68007-1-5C) by Proteintech is a Monoclonal antibody targeting Sortilin in Single Cell (Intra) applications with reactivity to Human samples G68007-1-5C targets Sortilin in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag28043 Product name: Recombinant human SORT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-831 aa of BC023542 Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human Sortilin (2B11B9) Calculated Molecular Weight: 831 aa, 92 kDa GenBank Accession Number: BC023542 Gene Symbol: Sortilin Gene ID (NCBI): 6272 ENSEMBL Gene ID: ENSG00000134243 RRID: AB_3673969 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGCAAGTACGCACCGGCCCATATAAGAAA Barcode Sequence: GCAAGTACGCACCGG Form: Liquid UNIPROT ID: Q99523 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924