Iright
BRAND / VENDOR: Proteintech

Proteintech, PE-FcA98387, FcZero-rAb™ PE Anti-Human CD16 Rabbit Recombinant Antibody

CATALOG NUMBER: PE-FcA98387
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The CD16 (PE-FcA98387) by Proteintech is a Recombinant antibody targeting CD16 in FC applications with reactivity to human samples PE-FcA98387 targets CD16 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information CD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg31662 Product name: Recombinant Human FCGR3A/CD16a (F176V) protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 17-208 aa of BC017865 Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ Predict reactive species Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a) Calculated Molecular Weight: 254 aa, 29 kDa GenBank Accession Number: BC017865 Gene Symbol: CD16a Gene ID (NCBI): 2214 ENSEMBL Gene ID: ENSG00000203747 Conjugate: PE Fluorescent Dye Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08637 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924