Proteintech, PY5P5-FcA98470, FcZero-rAb™ PE-Cyanine5.5 Anti-Human CD8a Rabbit Recombinant Antibody

Size: 100tests The CD8a (PY5P5-FcA98470) by Proteintech is a Recombinant antibody targeting CD8a in FC applications with reactivity to human samples PY5P5-FcA98470 targets CD8a in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs, Cynomolgus PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information CD8 is a transmembrane glycoprotein composed of two disulfide-linked chains. It can be present as a homodimer of CD8α or as a heterodimer of CD8α and CD8β (PMID: 3264320; 8253791). CD8 is found on most thymocytes. The majority of class I-restricted T cells express mostly the CD8αβ heterodimer while CD8αα homodimers alone have been found on some gut intraepithelial T cells, on some T cell receptor (TCR) γδ T cells and on NK cells (PMID: 2111591; 1831127; 8420975). CD8 acts as a co-receptor that binds to MHC class-I and participates in cytotoxic T-cell activation (PMID: 8499079). During T cell development, CD8 is required for positive selection of CD4-/CD8+ T cells (PMID: 1968084). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0819 Product name: Recombinant Human CD8a protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-182 aa of NM_001145873.1 Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Predict reactive species Full Name: CD8a molecule Calculated Molecular Weight: 26 kDa GenBank Accession Number: NM_001145873.1 Gene Symbol: CD8A Gene ID (NCBI): 925 ENSEMBL Gene ID: ENSG00000153563 Conjugate: PE-Cyanine5.5 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 692 nm Excitation Laser: Blue Laser (488 nm)/Green Laser (532 nm)/Yellow-Green Laser (561 nm) Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.