Iright
BRAND / VENDOR: Proteintech

Proteintech, SF98054-1-RR, Anti-Human CD5 Rabbit scFv Antibody

CATALOG NUMBER: SF98054-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD5 (SF98054-1-RR) by Proteintech is a Recombinant antibody targeting CD5 in FC applications with reactivity to human samples SF98054-1-RR targets CD5 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD5 is a type I transmembrane glycoprotein of the scavenger receptor cysteine-rich family (PMID: 12403363). CD5 is expressed on a majority of thymocytes, mature T cells, B cell subsets, and peripheral blood dendritic cells (PMID: 9858516; 6156984; 10379049; 1384337). CD5 may act as a receptor in regulating T-cell proliferation. It functions as a negative regulator of TCR signaling during thymocyte development (PMID: 7542801). Specification Tested Reactivity: human Host / Type: Rabbit / scFv Class: Recombinant Type: Single-chain variable fragment antibody (scFv) Immunogen: CatNo: Eg1119 Product name: Recombinant Human CD5 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 25-372 aa of NM_014207.4 Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP Predict reactive species Full Name: CD5 molecule Calculated Molecular Weight: 55 kDa GenBank Accession Number: NM_014207.4 Gene Symbol: CD5 Gene ID (NCBI): 921 ENSEMBL Gene ID: ENSG00000110448 Conjugate: Unconjugated Source: Anti-Human CD5 scFv from clone 240428A12, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His-C tag at the C-terminus. Form: Liquid Purification Method: Protein A purification Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin 300, pH 7.3. Storage Conditions: Store at 2-8°C. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924